PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN17084.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 332aa    MW: 38137.6 Da    PI: 7.2755
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN17084.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.51.3e-5351331128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPt++elv +yLk+k+++ k++l +vi e+d+yk+ePwd++      +++++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+v+s k
  KHN17084.1   5 VPPGFRFHPTEDELVGYYLKRKINSLKIDL-DVIVEIDLYKMEPWDIQDrckLGYEQQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAVMS-K 101
                 69****************************.99**************952432234677**************************************.8 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 ++ +g++ktLvfykgrap+g+ktdW+mheyr 
  KHN17084.1 102 NRIIGMRKTLVFYKGRAPNGRKTDWIMHEYRH 133
                 999***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-593154IPR003441NAC domain
PROSITE profilePS5100557.0285154IPR003441NAC domain
PfamPF023655.5E-286132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MESCVPPGFR FHPTEDELVG YYLKRKINSL KIDLDVIVEI DLYKMEPWDI QDRCKLGYEQ  60
QNEWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKAVMS KNRIIGMRKT LVFYKGRAPN  120
GRKTDWIMHE YRHQTSEHGP PQAKGWVVCR AFRKPSPSHR PGFDHPWCST SSQQQHFFRD  180
QIQSYSSRPL SIADILDETN NVPHPNAEGT SFSHPFSSDH QQHLNNLLSN QTVAIMDKQL  240
IELPQLDSPT ASLAIKECNQ QQHNGLTNEE YCSDERSNNS NAQGIDWKSL DNLFGSQLSD  300
NAAYFSHPNL PLMMPHNHDQ ASHILGCFPD SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-49215412168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006589457.10.0PREDICTED: NAC domain-containing protein 30-like isoform X1
SwissprotQ9C8W91e-115NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A0B2QAS50.0A0A0B2QAS5_GLYSO; NAC domain-containing protein 7
STRINGGLYMA10G36050.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-105vascular related NAC-domain protein 7
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]